PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_015869183.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
Family Dof
Protein Properties Length: 489aa    MW: 53289 Da    PI: 6.5025
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_015869183.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.84.8e-38119179262
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                     ++k l+cprC+s +tkfCy+nny+++qPryfCk+C+ryWt+GG++rnvPvG+grr+nk+ss
  XP_015869183.1 119 PDKVLPCPRCNSLETKFCYFNNYNVNQPRYFCKNCQRYWTAGGTIRNVPVGAGRRRNKHSS 179
                     78999*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-29108176IPR003851Zinc finger, Dof-type
PfamPF027012.9E-31120177IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.472123177IPR003851Zinc finger, Dof-type
PROSITE patternPS013610125161IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 489 aa     Download sequence    Send to blast
MSGSQLGDPA IKLFGTNIPV PESGFPVGSV HSSGFRSWVP PSAVPLVMDE CSEAKKAEVG  60
DPSVEKFCKQ DKLSELDNGK QTGFQIHGHR KENEVNHNSE DDKGAGCDKS GKEKALKKPD  120
KVLPCPRCNS LETKFCYFNN YNVNQPRYFC KNCQRYWTAG GTIRNVPVGA GRRRNKHSSP  180
QYHQTVAHAD AAPVTQGDTL NSDNHHHPSS IIIPASERPV NGMGNSLEFG TDAPLCESMA  240
TVLNLKDHNR SEISSAAVGD NCEEPSSSTS SLTDTSPLEN EYSGKENDGS NPTHPIQYYP  300
VPQWTYPWNP GWSFMTVGPD SSNTNHPYMG SLPMMAVPGF CAPNITFQLL PASCWGYMPS  360
WEARKLVTPL HGSTENLIPS SSTRNTGCSG SPTLGKHSRD TTLQAEDQTE QCLWVPKTLR  420
IDDPDEAAKS SIWSTLGIKP DKNESSVRDG LFKALPNKSG ANSHTSDADQ VLQSNPAAFS  480
RSQSFKENT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015869183.10.0PREDICTED: cyclic dof factor 1-like
TrEMBLW9QBM51e-162W9QBM5_9R
STRINGVIT_08s0056g01230.t011e-136(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.22e-75cycling DOF factor 2